PDB entry 1wlx

View 1wlx on RCSB PDB site
Description: Solution structure of the third spectrin repeat of alpha-actinin-4
Deposited on 2004-06-30, released 2005-08-09
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-actinin 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43707 (2-128)
      • cloning artifact (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wlxA (A:)
    gstekqleaidqlhleyakraapfnnwmesamedlqdmfivhtieeieglisahdqfkst
    lpdadrereailaihkeaqriaesnhiklsgsnpyttvtpqiinskwekvqqlvpkrdha
    lleeqskqq