PDB entry 1wlw

View 1wlw on RCSB PDB site
Description: Congerin II Y16S single mutant
Class: sugar binding protein
Keywords: galectin, beta-sandwich, thermostability, mutant, SUGAR BINDING PROTEIN
Deposited on 2004-06-30, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Congerin II
    Species: Conger myriaster [TaxId:7943]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YIC2 (Start-134)
      • engineered (15)
    Domains in SCOPe 2.08: d1wlwa_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlwA (A:)
    sdraevrnipfklgmsltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvl
    nslvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnl
    iylagdarltfvrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlwA (A:)
    draevrnipfklgmsltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
    slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
    ylagdarltfvrle