PDB entry 1wlt

View 1wlt on RCSB PDB site
Description: Crystal Structure of dTDP-4-dehydrorhamnose 3,5-epimerase homologue from Sulfolobus tokodaii
Class: isomerase
Keywords: jelly roll-like topology, flattened barrel, ISOMERASE
Deposited on 2004-06-29, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 176aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlta1
  • Chain 'B':
    Compound: 176aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wltb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wltA (A:)
    mgsshhhhhhssglvprgshmpfefenlgmgiilikpkvfpdkrgfflevfksedftkmr
    ipnviqtnmsfsrkgvvrglhyqrtpkeqgkiifvpkgrildvavdvrkssptfgkyvka
    elneenhymlwippgfahgfqaledsiviyfithneyspphercisysyidwpikeviis
    dkdlqcpslekaevfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wltA (A:)
    mpfefenlgmgiilikpkvfpdkrgfflevfksedftkmripnviqtnmsfsrkgvvrgl
    hyqrtpkeqgkiifvpkgrildvavdvrkssptfgkyvkaelneenhymlwippgfahgf
    qaledsiviyfithneyspphercisysyidwpikeviisdkdlqcpslekaevfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wltB (B:)
    mgsshhhhhhssglvprgshmpfefenlgmgiilikpkvfpdkrgfflevfksedftkmr
    ipnviqtnmsfsrkgvvrglhyqrtpkeqgkiifvpkgrildvavdvrkssptfgkyvka
    elneenhymlwippgfahgfqaledsiviyfithneyspphercisysyidwpikeviis
    dkdlqcpslekaevfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wltB (B:)
    mpfefenlgmgiilikpkvfpdkrgfflevfksedftkmripnviqtnmsfsrkgvvrgl
    hyqrtpkeqgkiifvpkgrildvavdvrkssptfgkyvkaelneenhymlwippgfahgf
    qaledsiviyfithneyspphercisysyidwpikeviisdkdlqcpslekaevfd