PDB entry 1wls

View 1wls on RCSB PDB site
Description: Crystal structure of L-asparaginase I homologue protein from Pyrococcus horikoshii
Class: hydrolase
Keywords: structural genomics, hydrolase
Deposited on 2004-06-29, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-asparaginase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0066
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57797 (0-327)
      • modified residue (0)
      • modified residue (7)
      • modified residue (47)
      • modified residue (85)
      • modified residue (91)
      • modified residue (95)
      • modified residue (109)
      • modified residue (146)
      • modified residue (157)
      • modified residue (289)
      • modified residue (299)
      • modified residue (315)
    Domains in SCOPe 2.07: d1wlsa_
  • Chain 'B':
    Compound: L-asparaginase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0066
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57797 (0-327)
      • modified residue (0)
      • modified residue (7)
      • modified residue (47)
      • modified residue (85)
      • modified residue (91)
      • modified residue (95)
      • modified residue (109)
      • modified residue (146)
      • modified residue (157)
      • modified residue (289)
      • modified residue (299)
      • modified residue (315)
    Domains in SCOPe 2.07: d1wlsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wlsA (A:)
    mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdw
    erlakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsda
    pfnlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklr
    ilhipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyr
    gtdlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklm
    wilghtknieevkqlmgknitgeltrvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wlsB (B:)
    mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdw
    erlakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsda
    pfnlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklr
    ilhipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyr
    gtdlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklm
    wilghtknieevkqlmgknitgeltrvs