PDB entry 1wlo

View 1wlo on RCSB PDB site
Description: Solution structure of the hypothetical protein from thermus thermophilus HB8
Deposited on 2004-06-28, released 2005-07-12
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SufE Protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wloA (A:)
    mvppklkqalelfkslpkelrsqvlleyaakvpppppgvelervhecqtpffvhadvegg
    kvrlyfhvpdeaptvkafagllreglegespeavlevppgfyrgygleefftplrlrgle
    aallrlqaqvrkalts