PDB entry 1wln

View 1wln on RCSB PDB site
Description: Solution structure of the FHA domain of mouse Afadin 6
Class: cell adhesion
Keywords: BETA SANDWICH, FHA DOMAIN, AF-6, S-Afadin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2004-06-28, released 2005-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Afadin
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA library 4932441D06
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZQ1 (7-113)
      • cloning artifact (0-6)
      • cloning artifact (114-119)
    Domains in SCOPe 2.08: d1wlna1, d1wlna2, d1wlna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wlnA (A:)
    gssgssgpeklpylvelspdgsdsrdkpklyrlqlsvtevgtekfddnsiqlfgpgiqph
    hcdltnmdgvvtvtprsmdaetyvdgqrisettmlqsgmrlqfgtshvfkfvdpsgpssg