PDB entry 1wlm

View 1wlm on RCSB PDB site
Description: Solution structure of mouse CGI-38 protein
Class: Structural genomics, unknown function
Keywords: CGI-38, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-06-28, released 2005-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein CGI-38
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2700055K07
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CRB6 (7-144)
    • cloning artifact (0-6)
    • cloning artifact (145-150)
  Domains in SCOPe 2.08: d1wlma1, d1wlma2, d1wlma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wlmA (A:)
  gssgssgmaastdiagleesfrkfaihgdpkasgqemngknwaklckdckvadgkavtgt
  dvdivfskvkaksarvinyeefkkaleelatkrfkgkskeeafdaicqliagkepanigv
  tkaktggavdrltdtskytgshkersgpssg