PDB entry 1wll

View 1wll on RCSB PDB site
Description: L122K mutant of FMN-binding protein from Desulfovibrio vulgaris (Miyazaki F)
Class: Electron transport
Keywords: Electron transport, Flavoprotein, FMN
Deposited on 2004-06-28, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered (121)
    Domains in SCOPe 2.08: d1wlla_
  • Chain 'B':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered (121)
    Domains in SCOPe 2.08: d1wllb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wllA (A:)
    mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wllB (B:)
    mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tk