PDB entry 1wlj

View 1wlj on RCSB PDB site
Description: human ISG20
Class: hydrolase
Keywords: exoribonuclease, hydrolase
Deposited on 2004-06-28, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon stimulated gene 20kDa
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_002192
    Domains in SCOPe 2.07: d1wlja_
  • Heterogens: MN, ACT, U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wljA (A:)
    magsrevvamdcemvglgphresglarcslvnvhgavlydkfirpegeitdyrtrvsgvt
    pqhmvgatpfavarleilqllkgklvvghdlkhdfqalkedmsgytiydtstdrllwrea
    kldhcrrvslrvlserllhksiqnsllghssvedaratmelyqisqrirarrglprlavs
    dlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wljA (A:)
    evvamdcemvglgphresglarcslvnvhgavlydkfirpegeitdyrtrvsgvtpqhmv
    gatpfavarleilqllkgklvvghdlkhdfqalkedmsgytiydtstdrllwreaklvsl
    rvlserllhksiqnsllghssvedaratmelyqisqrirarrglprla