PDB entry 1wlh

View 1wlh on RCSB PDB site
Description: molecular structure of the rod domain of dictyostelium filamin
Deposited on 2004-06-27, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.258
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlhA (A:)
    paadpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmv
    dngdgtydvefepkeagdyvinltldgdnvngfpktvtvkpapsaehsyaegeglvkvfd
    napaeftifavdtkgvartdggdpfevaingpdglvvdakvtdnndgtygvvydapvegn
    ynvnvtlrgnpiknmpidvkciegangedssfgsftftvaaknkkgevktyggdkfevsi
    tgpaeeitldaidnqdgtytaayslvgngrfstgvklngkhiegspfkqvlgnpgkknpe
    vksftttrtan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlhA (A:)
    paadpeksyaegpgldggecfqpskfkihavdpdgvdggdgfvvtiegpapvdpvmvdng
    dgtydvefepkeagdyvinltldgdnvngfpktvtvkpapsaehsyaegeglvkvfdnap
    aeftifavdtkgvartdggdpfevaingpdglvvdakvtdnndgtygvvydapvegnynv
    nvtlrgnpiknmpidvkciegangedssfgsftftvaaknkkgevktyggdkfevsitgp
    aeeitldaidnqdgtytaayslvgngrfstgvklngkhiegspfkqvlgnpgkknpevks
    ftttrtan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wlhB (B:)
    paadpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmv
    dngdgtydvefepkeagdyvinltldgdnvngfpktvtvkpapsaehsyaegeglvkvfd
    napaeftifavdtkgvartdggdpfevaingpdglvvdakvtdnndgtygvvydapvegn
    ynvnvtlrgnpiknmpidvkciegangedssfgsftftvaaknkkgevktyggdkfevsi
    tgpaeeitldaidnqdgtytaayslvgngrfstgvklngkhiegspfkqvlgnpgkknpe
    vksftttrtan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlhB (B:)
    adpeksyaegpgldggecfqpskfkihavdpdgvdggdgfvvtiegpapvdpvmvdngdg
    tydvefepkeagdyvinltldgdnvngfpktvtvkpapsaehsyaegeglvkvfdnapae
    ftifavdtkgvartdggdpfevaingpdglvvdakvtdnndgtygvvydapvegnynvnv
    tlrgnpiknmpidvkciegangedssfgsftftvaaknkkgevktyggdkfevsitgpae
    eitldaidnqdgtytaayslvgngrfstgvklngkhiegspfkqvlgnpgkknpevksft
    ttrtan