PDB entry 1wlg

View 1wlg on RCSB PDB site
Description: Crystal structure of FlgE31, a major fragment of the hook protein
Class: structural protein
Keywords: EAR-& motif, STRUCTURAL PROTEIN
Deposited on 2004-06-25, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar hook protein flgE
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlga_
  • Chain 'B':
    Compound: Flagellar hook protein flgE
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlgA (A:)
    gldvaisqngffrlvdsngsvfysrngqfkldenrnlvnmqgmqltgypatgtpptiqqg
    anpapitipntlmaakstttasmqinlnstdpvpsktpfsvsdadsynkkgtvtvydsqg
    nahdmnvyfvktkdnewavythdssdpaatapttasttlkfnengilesggtvnittgti
    ngataatfslsflnsmqqntgannivatnqngykpgdlvsyqinndgtvvgnysneqeqv
    lgqivlanfanneglasqgdnvwaatqasgvallgtagsgnfgkltngaleasnvdlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlgA (A:)
    gldvaisqngffrlvdsngsvfysrngqfkldenrnlvnmqgmqltgypatgtpptiqqg
    anpapitipntlmaakstttasmqinlnstdpvpsktpfsvsdadsynkkgtvtvydsqg
    nahdmnvyfvktkdnewavythdssdpaatapttasttlkfnengilesggtvnittgti
    ngataatfslsflnsmqqntgannivatnqngykpgdlvsyqinndgtvvgnysneqeqv
    lgqivlanfanneglasqgdnvwaatqasgvallgtagsgnfgkltngaleas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wlgB (B:)
    gldvaisqngffrlvdsngsvfysrngqfkldenrnlvnmqgmqltgypatgtpptiqqg
    anpapitipntlmaakstttasmqinlnstdpvpsktpfsvsdadsynkkgtvtvydsqg
    nahdmnvyfvktkdnewavythdssdpaatapttasttlkfnengilesggtvnittgti
    ngataatfslsflnsmqqntgannivatnqngykpgdlvsyqinndgtvvgnysneqeqv
    lgqivlanfanneglasqgdnvwaatqasgvallgtagsgnfgkltngaleasnvdlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlgB (B:)
    gldvaisqngffrlvdsngsvfysrngqfkldenrnlvnmqgmqltgypatgtpptiqqg
    anpapitipntlmaakstttasmqinlnstdpvpsktpfsvsdadsynkkgtvtvydsqg
    nahdmnvyfvktkdnewavythdssdpaatapttasttlkfnengilesggtvnittgti
    ngataatfslsflnsmqqntgannivatnqngykpgdlvsyqinndgtvvgnysneqeqv
    lgqivlanfanneglasqgdnvwaatqasgvallgtagsgnfgkltngaleas