PDB entry 1wlf

View 1wlf on RCSB PDB site
Description: structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain
Deposited on 2004-06-25, released 2004-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.213
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlfA (A:)
    ssdrlagagsggavvtvaftnardcflhlprrlvaqlhllqnqaievasdhqptylswve
    grhfndqsenvaeinrqvgqklglssgdqvflrpcshvvscqqveveplsaddweilelh
    aisleqhlldqirivfpkavvpiwvdqqtyifiqivtlmpaapygrletntklliqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlfA (A:)
    ggavvtvaftnardcflhlprrlvaqlhllqnqaievasdhqptylswvegrhfnenvae
    inrqvgqklglssgdqvflrpcshvvscqqveveplsaddweilelhaisleqhlldqir
    ivfpkavvpiwvdqqtyifiqivtlmpaapygrletntklliqp