PDB entry 1wlf

View 1wlf on RCSB PDB site
Description: Structure of the N-terminal domain of PEX1 AAA-ATPase: Characterization of a putative adaptor-binding domain
Class: protein transport
Keywords: n-terminal domain, protein transport
Deposited on 2004-06-25, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome biogenesis factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlfa1, d1wlfa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlfA (A:)
    ssdrlagagsggavvtvaftnardcflhlprrlvaqlhllqnqaievasdhqptylswve
    grhfndqsenvaeinrqvgqklglssgdqvflrpcshvvscqqveveplsaddweilelh
    aisleqhlldqirivfpkavvpiwvdqqtyifiqivtlmpaapygrletntklliqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlfA (A:)
    ggavvtvaftnardcflhlprrlvaqlhllqnqaievasdhqptylswvegrhfnenvae
    inrqvgqklglssgdqvflrpcshvvscqqveveplsaddweilelhaisleqhlldqir
    ivfpkavvpiwvdqqtyifiqivtlmpaapygrletntklliqp