PDB entry 1wle

View 1wle on RCSB PDB site
Description: Crystal Structure of mammalian mitochondrial seryl-tRNA synthetase complexed with seryl-adenylate
Deposited on 2004-06-25, released 2005-09-06
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SERYL-tRNA SYNTHETASE
    Species: Bos taurus [TaxId:9913]
    Gene: SerRSmt
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SERYL-tRNA SYNTHETASE
    Species: Bos taurus [TaxId:9913]
    Gene: SerRSmt
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SRP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wleA (A:)
    mghhhhhhssglvprgsaterqdrnllyeharegysalplldmeslcaypedaaraldlr
    kgelrskdlpgiistwqelrqlreqirsleeekeavteavralvvnqdnsqvqqdpqyqs
    lrargreirkqltllypkeaqleeqfylralrlpnqthpdvpvgdesqarvlhvvgdkpa
    fsfqprghleiaekldiirqkrlshvsghrsyylrgagallqhglvnftlnklihrgftp
    mtvpdllrgvvfegcgmtpnakpsqiynidpsrfedlnlagtaevglagyfmdhsvafrd
    lpirmvcsstcyraetdtgkepwglyrvhhftkvemfgvtgpgleqsselleeflslqme
    iltelglhfrvldmptqelglpayrkfdieawmpgrgrfgevtsasnctdfqsrrlhimf
    qteagelqfahtvnatgcavprlliallesyqqkdgsvlvppalqpylgtdrittpthvp
    lqyigpnqpqkprlpgqpass
    

    Sequence, based on observed residues (ATOM records):
    >1wleA (A:)
    rnllyeharegysalplldmeslcaypedaaraldlrkgelrskdlpgiistwqelrqlr
    eqirsleeekeavteavralvvnqdnsqvqqdpqyqslrargreirkqltllypkeaqle
    eqfylralrlpnqthpdvpvgdesqarvlhvvgdkpafsfqprghleiaekldiirqkrl
    shvsghrsyylrgagallqhglvnftlnklihrgftpmtvpdllrgvvfegcgmtpnakp
    sqiynidpsrfedlnlagtaevglagyfmdhsvafrdlpirmvcsstcyraetdtgpwgl
    yrvhhftkvemfgvtgpgleqsselleeflslqmeiltelglhfrvldmptqelglpayr
    kfdieawmpgrgrfgevtsasnctdfqsrrlhimfqteagelqfahtvnatgcavprlli
    allesyqqkdgsvlvppalqpylgtdrittpthvplqyigpnqpq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wleB (B:)
    mghhhhhhssglvprgsaterqdrnllyeharegysalplldmeslcaypedaaraldlr
    kgelrskdlpgiistwqelrqlreqirsleeekeavteavralvvnqdnsqvqqdpqyqs
    lrargreirkqltllypkeaqleeqfylralrlpnqthpdvpvgdesqarvlhvvgdkpa
    fsfqprghleiaekldiirqkrlshvsghrsyylrgagallqhglvnftlnklihrgftp
    mtvpdllrgvvfegcgmtpnakpsqiynidpsrfedlnlagtaevglagyfmdhsvafrd
    lpirmvcsstcyraetdtgkepwglyrvhhftkvemfgvtgpgleqsselleeflslqme
    iltelglhfrvldmptqelglpayrkfdieawmpgrgrfgevtsasnctdfqsrrlhimf
    qteagelqfahtvnatgcavprlliallesyqqkdgsvlvppalqpylgtdrittpthvp
    lqyigpnqpqkprlpgqpass
    

    Sequence, based on observed residues (ATOM records):
    >1wleB (B:)
    qdrnllyeharegysalplldmeslcaypedaaraldlrkgelrskdlpgiistwqelrq
    lreqirsleeekeavteavralvvnqdnsqvqqdpqyqslrargreirkqltllypkeaq
    leeqfylralrlpnqthpdvpvgdesqarvlhvvgdkpafsfqprghleiaekldiirqk
    rlshvsghrsyylrgagallqhglvnftlnklihrgftpmtvpdllrgvvfegcgmtpna
    kpsqiynidpsrfedlnlagtaevglagyfmdhsvafrdlpirmvcsstcyraetdtgke
    pwglyrvhhftkvemfgvtgpgleqsselleeflslqmeiltelglhfrvldmptqelgl
    payrkfdieawmpgrgrfgevtsasnctdfqsrrlhimfqteagelqfahtvnatgcavp
    rlliallesyqqkdgsvlvppalqpylgtdrittpthvplqyigpnqpq