PDB entry 1wld

View 1wld on RCSB PDB site
Description: Congerin II T88I single mutant
Class: sugar binding protein
Keywords: galectin, beta-sandwich, thermostability, mutant, SUGAR BINDING PROTEIN
Deposited on 2004-06-22, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Congerin II
    Species: Conger myriaster [TaxId:7943]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YIC2 (Start-134)
      • engineered (87)
    Domains in SCOPe 2.07: d1wlda_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wldA (A:)
    sdraevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvl
    nslvhnvgwqqeerskkfpftkgdhfqititfdthtfyiqlsngetvefpnrnkdaafnl
    iylagdarltfvrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wldA (A:)
    draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
    slvhnvgwqqeerskkfpftkgdhfqititfdthtfyiqlsngetvefpnrnkdaafnli
    ylagdarltfvrle