PDB entry 1wlc

View 1wlc on RCSB PDB site
Description: Congerin II Y16S/T88I double mutant
Class: sugar binding protein
Keywords: galectin, beta-sandwich, thermostability, double-mutant, SUGAR BINDING PROTEIN
Deposited on 2004-06-22, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Congerin II
    Species: Conger myriaster [TaxId:7943]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YIC2 (Start-134)
      • engineered (15)
      • engineered (87)
    Domains in SCOPe 2.08: d1wlca_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlcA (A:)
    sdraevrnipfklgmsltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvl
    nslvhnvgwqqeerskkfpftkgdhfqititfdthtfyiqlsngetvefpnrnkdaafnl
    iylagdarltfvrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlcA (A:)
    draevrnipfklgmsltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
    slvhnvgwqqeerskkfpftkgdhfqititfdthtfyiqlsngetvefpnrnkdaafnli
    ylagdarltfvrle