PDB entry 1wl8

View 1wl8 on RCSB PDB site
Description: Crystal structure of PH1346 protein from Pyrococcus horikoshii
Class: ligase
Keywords: Transferase, GATases, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ligase
Deposited on 2004-06-21, released 2005-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.156
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GMP synthase [glutamine-hydrolyzing] subunit A
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59071 (0-End)
      • modified residue (111)
      • modified residue (147)
    Domains in SCOPe 2.06: d1wl8a1
  • Heterogens: CL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wl8A (A:)
    mmivimdnggqyvhriwrtlrylgvetkiipnttpleeikamnpkgiifsggpslentgn
    cekvlehydefnvpilgiclghqliakffggkvgrgekaeyslveieiidexeifkglpk
    rlkvweshmdevkelppkfkilarsetcpieamkheelpiygvqfhpevahtekgeeilr
    nfaklcgel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wl8A (A:)
    mmivimdnggqyvhriwrtlrylgvetkiipnttpleeikamnpkgiifsggpslentgn
    cekvlehydefnvpilgiclghqliakffggkvgrgekaeyslveieiidexeifkglpk
    rlkvweshmdevkelppkfkilarsetcpieamkheelpiygvqfhpevahtekgeeilr
    nfaklcge