PDB entry 1wl7

View 1wl7 on RCSB PDB site
Description: Structure of the thermostable arabinanase
Class: hydrolase
Keywords: arabinanase, ABN-TS, thermostable enzyme, glycoside hydrolase, Bacillus
Deposited on 2004-06-21, released 2005-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arabinanase-TS
    Species: Geobacillus thermodenitrificans [TaxId:33940]
    Database cross-references and differences (RAF-indexed):
    • GB JC7817 (0-311)
    Domains in SCOPe 2.06: d1wl7a1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wl7A (A:)
    vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
    rvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtldp
    rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
    aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
    pyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqir
    plywddegwpyl