PDB entry 1wl4

View 1wl4 on RCSB PDB site
Description: Human cytosolic acetoacetyl-CoA thiolase complexed with CoA
Class: transferase
Keywords: thiolase fold, TRANSFERASE
Deposited on 2004-06-20, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.107
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-Coenzyme A acetyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BWD1 (Start-396)
      • modified residue (91)
      • conflict (168)
      • conflict (261)
    Domains in SCOPe 2.07: d1wl4a1, d1wl4a2
  • Heterogens: SO4, COA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wl4A (A:)
    mnagsdpvvivsaartiigsfngalaavpvqdlgstvikevlkratvapedvsevifghv
    laagcgqnpvrqasvgagipysvpawscqmicgsglkavclavqsigigdssivvaggme
    nmskaphlaylrtgvkigempltdsilcdgltdafhnchmgitaenvakkwqvsredqdk
    vavlsqnrtenaqkaghfdkeivpvlvstrkglievktdefprhgsnieamsklkpyflt
    dgtgtvtpanasgindgaaavvlmkkseadkrgltplarivswsqvgvepsimgigpipa
    ikqavtkagwsledvdifeineafaavsaaivkelglnpekvnieggaialghplgasgc
    rilvtllhtlermgrsrgvaalcigggmgiamcvqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wl4A (A:)
    gsdpvvivsaartiigsfngalaavpvqdlgstvikevlkratvapedvsevifghvlaa
    gcgqnpvrqasvgagipysvpawscqmicgsglkavclavqsigigdssivvaggmenms
    kaphlaylrtgvkigempltdsilcdgltdafhnchmgitaenvakkwqvsredqdkvav
    lsqnrtenaqkaghfdkeivpvlvstrkglievktdefprhgsnieamsklkpyfltdgt
    gtvtpanasgindgaaavvlmkkseadkrgltplarivswsqvgvepsimgigpipaikq
    avtkagwsledvdifeineafaavsaaivkelglnpekvnieggaialghplgasgcril
    vtllhtlermgrsrgvaalcigggmgiamcvqre