PDB entry 1wl1

View 1wl1 on RCSB PDB site
Description: Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima H74A mutant
Deposited on 2004-06-18, released 2005-06-28
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: 0.229
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: octoprenyl-diphosphate synthase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1M1
      • engineered (73)
  • Chain 'B':
    Compound: octoprenyl-diphosphate synthase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1M1
      • engineered (73)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wl1A (A:)
    mtknklnqnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveig
    edaisslaalelvalasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtv
    eeignnklrraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpal
    legelgedlynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfp
    earqmfenrdwsglmsfmrekgilkeceetlkvlvknviienswlrdfvdgifkikiss
    

    Sequence, based on observed residues (ATOM records):
    >1wl1A (A:)
    nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
    alelvalasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl
    rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
    lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
    rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wl1B (B:)
    mtknklnqnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveig
    edaisslaalelvalasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtv
    eeignnklrraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpal
    legelgedlynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfp
    earqmfenrdwsglmsfmrekgilkeceetlkvlvknviienswlrdfvdgifkikiss
    

    Sequence, based on observed residues (ATOM records):
    >1wl1B (B:)
    nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
    alelvalasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl
    rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
    lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
    rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf