PDB entry 1wky

View 1wky on RCSB PDB site
Description: Crystal structure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module
Class: hydrolase
Keywords: TIM BARREL, CATALYTIC DOMAIN, CBM, hydrolase
Deposited on 2004-06-15, released 2005-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-1,4-Mannanase
    Species: Bacillus sp. [TaxId:244966]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkya1, d1wkya2
  • Heterogens: CL, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkyA (A:)
    grpanansgfyvsgttlydangnpfvmrginhghawykdqattaiegiantgantvrivl
    sdggqwtkddiqtvrnlislaednnlvavlevhdatgydsiaslnravdywiemrsalig
    kedtviinianewfgswdgaawadgykqaiprlrnaglnntlmidaagwgqfpqsihdyg
    revfnadpqrntmfsihmyeyaggnasqvrtnidrvlnqdlalvigefghrhtngdvdes
    timsyseqrgvgwlawswkgngpeweyldlsndwagnnltawgntivngpyglretskls
    tvftgggsdgrtspttlydfeestqgwtgsslsrgpwtvtewsskgnhslkadiqmssns
    qhylhviqnrslqqnsriqatvkhanwgsvgngmtarlyvktghgytwysgsfvpingss
    gttlsldlsnvqnlsqvreigvqfqsesnssgqtsiyidnvive
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkyA (A:)
    grpansgfyvsgttlydangnpfvmrginhghawykdqattaiegiantgantvrivlsd
    ggqwtkddiqtvrnlislaednnlvavlevhdatgydsiaslnravdywiemrsaligke
    dtviinianewfgswdgaawadgykqaiprlrnaglnntlmidaagwgqfpqsihdygre
    vfnadpqrntmfsihmyeyaggnasqvrtnidrvlnqdlalvigefghrhtngdvdesti
    msyseqrgvgwlawswkgngpeweyldlsndwagnnltawgntivngpyglretsklstv
    ftpttlydfeestqgwtgsslsrgpwtvtewsskgnhslkadiqmssnsqhylhviqnrs
    lqqnsriqatvkhagmtarlyvktghgytwysgsfvpingssgttlsldlsnvqnlsqvr
    eigvqfqsesnssgqtsiyidnvive