PDB entry 1wkw

View 1wkw on RCSB PDB site
Description: Crystal structure of the ternary complex of eIF4E-m7GpppA-4EBP1 peptide
Class: translation/protein binding
Keywords: translation, initiation factor, cap-binding protein, mRNA-cap, TRANSLATION-PROTEIN BINDING COMPLEX
Deposited on 2004-06-10, released 2005-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eukaryotic translation initiation factor 4e
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06730 (0-190)
  Domains in SCOPe 2.07: d1wkwa_
• Chain 'B':
  Compound: eukaryotic translation initiation factor 4e binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13541 (0-19)
• Heterogens: GTA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wkwA (A:)
  evanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlm
  pgcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddys
  ddvcgavvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatk
  sgsttknrfvv
  

  
  
• Chain 'B':
  No sequence available.