PDB entry 1wkw

View 1wkw on RCSB PDB site
Description: Crystal structure of the ternary complex of eIF4E-m7GpppA-4EBP1 peptide
Class: translation/protein binding
Keywords: translation, initiation factor, cap-binding protein, mRNA-cap, TRANSLATION/PROTEIN BINDING COMPLEX
Deposited on 2004-06-10, released 2005-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wkwa_
  • Chain 'B':
    Compound: eukaryotic translation initiation factor 4e binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wkwA (A:)
    evanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlm
    pgcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddys
    ddvcgavvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatk
    sgsttknrfvv
    

  • Chain 'B':
    No sequence available.