PDB entry 1wkv

View 1wkv on RCSB PDB site
Description: Crystal structure of O-phosphoserine sulfhydrylase
Class: transferase
Keywords: Homodimer, Open alpha/beta folding, TRANSFERASE
Deposited on 2004-06-09, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE1586
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkva1
  • Chain 'B':
    Compound: Cysteine synthase
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE1586
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkvb_
  • Heterogens: ACT, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkvA (A:)
    maladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripv
    gdgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewyn
    pfslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaae
    efgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtar
    eifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrve
    tgmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlep
    gdyvvvvpdtgfkylslvqnalegagdsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkvA (A:)
    aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
    dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
    fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
    fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
    ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
    gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
    dyvvvvpdtgfkylslvqnale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wkvB (B:)
    maladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripv
    gdgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewyn
    pfslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaae
    efgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtar
    eifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrve
    tgmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlep
    gdyvvvvpdtgfkylslvqnalegagdsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkvB (B:)
    aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
    dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
    fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
    fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
    ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
    gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
    dyvvvvpdtgfkylslvqnaleg