PDB entry 1wkt

View 1wkt on RCSB PDB site
Description: williopsis mrakii killer toxin, nmr solution structure
Class: toxin
Keywords: yeast killer toxin, nmr, williopsis mrakii
Deposited on 1996-05-08, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: yeast killer toxin
  Species: Williopsis saturnus var. mrakii [TaxId:4963]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10410 (0-87)
  Domains in SCOPe 2.06: d1wkta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wktA (A:)
  gdgylimckncdpntgscdwkqnwntcvgiganvhwmvtggstdgkqgcatiwegsgcvg
  rsttmccpantccnintgfyirsyrrve