PDB entry 1wkt

View 1wkt on RCSB PDB site
Description: williopsis mrakii killer toxin, nmr solution structure
Deposited on 1996-05-08, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1wkt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wkt_ (-)
    gdgylimckncdpntgscdwkqnwntcvgiganvhwmvtggstdgkqgcatiwegsgcvg
    rsttmccpantccnintgfyirsyrrve