PDB entry 1wkt

View 1wkt on RCSB PDB site
Description: williopsis mrakii killer toxin, nmr solution structure
Class: toxin
Keywords: yeast killer toxin, nmr, williopsis mrakii
Deposited on 1996-05-08, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yeast killer toxin
    Species: Williopsis saturnus var. mrakii [TaxId:4963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wktA (A:)
    gdgylimckncdpntgscdwkqnwntcvgiganvhwmvtggstdgkqgcatiwegsgcvg
    rsttmccpantccnintgfyirsyrrve