PDB entry 1wkr

View 1wkr on RCSB PDB site
Description: Crystal structure of aspartic proteinase from Irpex lacteus
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-06-02, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.147
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyporopepsin
    Species: Irpex lacteus [TaxId:5319]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17576 (0-339)
      • see remark 999 (193)
    Domains in SCOPe 2.07: d1wkra_
  • Chain 'I':
    Compound: pepstatin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1WKR (0-5)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wkrA (A:)
    aagsvpatnqlvdyvvnvgvgspattysllvdtgssntwlgadksyvktstssatsdkvs
    vtygsgsfsgteytdtvtlgsltipkqsigvasrdsgfdgvdgilgvgpvdltvgtlsph
    tstsiptvtdnlfsqgtiptnllavsfepttsesstngeltfgatdsskytgsitytpit
    stspasaywginqsirygsstsilsstagivdtgttltliasdafakykkatgavadnnt
    gllrlttaqyanlqslfftiggqtfeltanaqiwprnlntaiggsassvylivgdlgsds
    gegldfingltflerfysvydttnkrlglattsfttatsn
    

  • Chain 'I':
    No sequence available.