PDB entry 1wkq

View 1wkq on RCSB PDB site
Description: Crystal Structure of Bacillus subtilis Guanine Deaminase. The first domain-swapped structure in the cytidine deaminase superfamily
Deposited on 2004-06-01, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.161
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1wkqa_
  • Chain 'B':
    Domains in SCOP 1.69: d1wkqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkqA (A:)
    mhhhhhhamnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndpta
    haevtairkackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagf
    ddsfiykeidkpaeertipfyqvtltehlspfqawrnfankkey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkqA (A:)
    hamnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevta
    irkackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiy
    keidkpaeertipfyqvtltehlspfqawrnfankkey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wkqB (B:)
    mhhhhhhamnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndpta
    haevtairkackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagf
    ddsfiykeidkpaeertipfyqvtltehlspfqawrnfankkey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkqB (B:)
    nhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtairk
    ackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiykei
    dkpaeertipfyqvtltehlspfqawrnfankkey