PDB entry 1wkq

View 1wkq on RCSB PDB site
Description: Crystal Structure of Bacillus subtilis Guanine Deaminase. The first domain-swapped structure in the cytidine deaminase superfamily
Class: hydrolase
Keywords: Guanine deaminase, domain swap, the cytidine deaminase superfamily, substrate specificity, structural plasticity, HYDROLASE
Deposited on 2004-06-01, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.161
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: guanine deaminase
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34598 (8-163)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d1wkqa1, d1wkqa2
  • Chain 'B':
    Compound: guanine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: guanine deaminase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkqb_
  • Heterogens: ZN, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkqA (A:)
    mhhhhhhamnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndpta
    haevtairkackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagf
    ddsfiykeidkpaeertipfyqvtltehlspfqawrnfankkey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkqA (A:)
    hamnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevta
    irkackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiy
    keidkpaeertipfyqvtltehlspfqawrnfankkey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wkqB (B:)
    mhhhhhhamnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndpta
    haevtairkackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagf
    ddsfiykeidkpaeertipfyqvtltehlspfqawrnfankkey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkqB (B:)
    nhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtairk
    ackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiykei
    dkpaeertipfyqvtltehlspfqawrnfankkey