PDB entry 1wkp

View 1wkp on RCSB PDB site
Description: Flowering locus t (ft) from arabidopsis thaliana
Class: signaling protein
Keywords: cis-peptide, pebp, SIGNALING PROTEIN
Deposited on 2004-06-01, released 2005-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FLOWERING LOCUS T protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: FT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SXZ2 (Start-170)
      • engineered (44)
      • engineered (109)
      • engineered (166)
    Domains in SCOPe 2.08: d1wkpa_
  • Chain 'B':
    Compound: FLOWERING LOCUS T protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: FT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SXZ2
      • engineered (44)
      • engineered (109)
      • engineered (166)
    Domains in SCOPe 2.08: d1wkpb_
  • Chain 'C':
    Compound: FLOWERING LOCUS T protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: FT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SXZ2
      • engineered (44)
      • engineered (109)
      • engineered (166)
    Domains in SCOPe 2.08: d1wkpc_
  • Chain 'D':
    Compound: FLOWERING LOCUS T protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: FT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SXZ2
      • engineered (44)
      • engineered (109)
      • engineered (166)
    Domains in SCOPe 2.08: d1wkpd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkpA (A:)
    gshmsinirdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveig
    gedlrnfytlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagi
    hrvvfilfrqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkpA (A:)
    rdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveiggedlrnfy
    tlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilf
    rqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wkpB (B:)
    gshmsinirdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveig
    gedlrnfytlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagi
    hrvvfilfrqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkpB (B:)
    rdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveiggedlrnfy
    tlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilf
    rqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wkpC (C:)
    gshmsinirdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveig
    gedlrnfytlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagi
    hrvvfilfrqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkpC (C:)
    rdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveiggedlrnfy
    tlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilf
    rqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wkpD (D:)
    gshmsinirdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveig
    gedlrnfytlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagi
    hrvvfilfrqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkpD (D:)
    rdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveiggedlrnfy
    tlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilf
    rqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqre