PDB entry 1wkm

View 1wkm on RCSB PDB site
Description: the product bound form of the mn(II)loaded methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Class: Hydrolase
Keywords: AMINOPEPTIDASE, HYPERTHERMOPHILE, METHIONINE COMPLEX, Hydrolase
Deposited on 2004-06-01, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkma1, d1wkma2
  • Chain 'B':
    Compound: Methionine aminopeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkmb1, d1wkmb2
  • Heterogens: MN, MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wkmA (A:)
    mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
    ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
    varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
    gdvfaiepfatigagqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwl
    qndmpegqlklalktlekagaiygypvlkeirngivaqfehtiivekdsvivtte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wkmB (B:)
    mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
    ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
    varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
    gdvfaiepfatigagqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwl
    qndmpegqlklalktlekagaiygypvlkeirngivaqfehtiivekdsvivtte