PDB entry 1wkl
View 1wkl on RCSB PDB site
Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8 in Complex with ATP and ADP
Class: transferase
Keywords: nucleotide diphosphate kinase, complex with ATP and ADP, reaction intermediate, Thermus thermophilus HB8, kinase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on
2004-06-01, released
2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated
2014-04-23, with a file datestamp of
2014-04-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: nucleotide diphosphate kinase
Species: Thermus thermophilus [TaxId:274]
Gene: ndk
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1wkla_ - Chain 'B':
Compound: nucleotide diphosphate kinase
Species: Thermus thermophilus [TaxId:274]
Gene: ndk
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1wklb_ - Heterogens: MG, PHS, ADP, ATP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1wklA (A:)
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1wklB (B:)
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell