PDB entry 1wkl

View 1wkl on RCSB PDB site
Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8 in Complex with ATP and ADP
Class: transferase
Keywords: nucleotide diphosphate kinase, complex with ATP and ADP, reaction intermediate, Thermus thermophilus HB8, kinase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2004-06-01, released 2005-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleotide diphosphate kinase
    Species: Thermus thermophilus [TaxId:274]
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wkla_
  • Chain 'B':
    Compound: nucleotide diphosphate kinase
    Species: Thermus thermophilus [TaxId:274]
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wklb_
  • Heterogens: MG, PHS, ADP, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wklA (A:)
    mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
    lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
    edaqreialffrpeell
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wklB (B:)
    mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
    lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
    edaqreialffrpeell