PDB entry 1wkk

View 1wkk on RCSB PDB site
Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8 in Complex with GDP
Class: transferase
Keywords: nucleoside diphosphate kinase, complex with GDP, Thermus themophilus HB8, kinase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-06-01, released 2005-08-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Thermus thermophilus
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wkka1
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Thermus thermophilus
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wkkb1
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wkkA (A:)
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wkkB (B:)
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell