PDB entry 1wki

View 1wki on RCSB PDB site
Description: solution structure of ribosomal protein L16 from thermus thermophilus HB8
Class: ribosome
Keywords: MIXED ALPHA/BETA, RIBOSOME, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-31, released 2004-12-14
The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-14, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: LSU ribosomal protein L16P
  Species: Thermus thermophilus
  Gene: RPLP
  Domains in SCOP 1.75: d1wkia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wkiA (A:)
  mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
  ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
  aghklpiktkivrrdaydeaq