PDB entry 1wkg

View 1wkg on RCSB PDB site
Description: Acetylornithine aminotransferase from thermus thermophilus HB8
Class: transferase
Keywords: AMINOTRANSFERASE, PLP, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2004-05-31, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine/acetyl-lysine aminotransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkga_
  • Chain 'B':
    Compound: Acetylornithine/acetyl-lysine aminotransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkgb_
  • Heterogens: POI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkgA (A:)
    metrtledwralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlg
    hgnpevveavkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaa
    lkfarahtgrkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkr
    avdeetaavilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfaf
    ehfgivpdiltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairy
    lertrlweraaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrv
    lalqagptvirflpplviekedlervveavravla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkgA (A:)
    wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
    avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
    grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
    vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
    iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
    raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
    virflpplviekedlervveavravla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wkgB (B:)
    metrtledwralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlg
    hgnpevveavkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaa
    lkfarahtgrkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkr
    avdeetaavilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfaf
    ehfgivpdiltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairy
    lertrlweraaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrv
    lalqagptvirflpplviekedlervveavravla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkgB (B:)
    wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
    avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
    grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
    vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
    iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
    raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
    virflpplviekedlervveavravla