PDB entry 1wkd

View 1wkd on RCSB PDB site
Description: tRNA-guanine transglycosylase
Class: tRNA-modifying enzyme
Keywords: tRNA-modifying enzyme
Deposited on 1996-08-06, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.204
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-guanine transglycosylase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: tgt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • engineered (101)
    Domains in SCOPe 2.07: d1wkda_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkdA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltasggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkdA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltasggyqvmslssltkqseegvtfkshldg
    srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
    eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
    lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
    lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
    sqfaqdfraryf