PDB entry 1wkb

View 1wkb on RCSB PDB site
Description: Crystal Structure of Leucyl-tRNA Synthetase from the Archaeon Pyrococcus horikoshii Reveals a Novel Editing Domain Orientation
Deposited on 2004-05-30, released 2005-02-08
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wkbA (A:)
    maelnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytip
    dviarfkrmqgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfe
    dpinivkyfmkaaketfiragfsvdwsrefyttslfppfskfiewqfwklkekgyivkga
    hrvrwdpvvgtplgdhdlmegedvpildyiiikfelrengeviylpaatlrpetvygvtn
    mwvnpnatyvkakvrrkdkeetwivskeaayklsfqdreievieefkgekligkyvrnpv
    sgdeviilpaefvdpdnatgvvmsvpahapfdhvaledlkreteilekydidprivenit
    yisliklegygdfpaveevnklgiksqkdkekleqatktiykaeyhkgifkvppyegkpv
    qevkeaiakemlekgiaeimyefaeknvisrfgnravikiihdqwfidygnpewkekark
    alermkilpetrraqfeaiidwldkkacarkiglgtplpwdpewvieslsdstiymayyt
    isrhinklrqegkldpekltpeffdyifleefsedkekelekktgipaeiihemkeefey
    wypldwrcsgkdlipnhltffifnhvaifreehwpkgiavngfgtlegqkmskskgnvln
    fidaieengadvvrlyimslaehdsdfdwrrkevgklrkqierfyelisqfaeyevkgnv
    elkdidrwmlhrlnkaikettnaleefrtrtavqwafysimndlrwylrrtegrddeakr
    yvlrtladvwvrlmapftphiceelweklg
    

    Sequence, based on observed residues (ATOM records):
    >1wkbA (A:)
    lnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytipdvi
    arfkrmqgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfedpi
    nivkyfmkaaketfiragfsvdwsrefyttslfppfskfiewqfwklkekgyivkgahrv
    rwdpvvgtplgdhdlmegedvpildyiiikfelrengeviylpaatlrpetvygvtnmwv
    npnatyvkakvrrkdkeetwivskeaayklsfqdreievieefkgekligkyvrnpvsgd
    eviilpaefvdpdnatgvvmsvpahapfdhvaledlkreteilekydidprivfpaveev
    nklgiksqkdkekleqatktiykaeyhkgifkvppyegkpvqevkeaiakemlekgiaei
    myefaeknvisrfgnravikiihdqwfidygnpewkekarkalermkilpetrraqfeai
    idwldkkacarkiglgtplpwdpewvieslsdstiymayytisrhinklrqegkldpekl
    tpeffdyifleefsedkekelekktgipaeiihemkeefeywypldwrcsgkdlipnhlt
    ffifnhvaifreehwpkgiavngfgtlegqkmskskgnvlnfidaieengadvvrlyims
    laehdsdfdwrrkevgklrkqierfyelisqfaeyevkgnvelkdidrwmlhrlnkaike
    ttnaleefrtrtavqwafysimndlrwylrrtegrddeakryvlrtladvwvrlmapftp
    hiceelweklg