PDB entry 1wka

View 1wka on RCSB PDB site
Description: Structural basis for non-cognate amino acid discrimination by the valyl-tRNA synthetase editing domain
Class: ligase
Keywords: editing, cp1, valyl-trna synthetase, fidelity, thermus thrmophilus, translation, amino acid, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2004-05-30, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: valyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wkaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkaA (A:)
    mtpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevw
    ipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrg
    ldrfearrkavelfreaghlvkeedyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkaA (A:)
    gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi
    ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr
    fearrkavelfreaghlvkeedy