PDB entry 1wk9

View 1wk9 on RCSB PDB site
Description: Structural basis for non-cognate amino acid discrimination by the valyl-tRNA synthetase editing domain
Class: Ligase
Keywords: editing, cp1, valyl-trna synthetase, fidelity, thermus thrmophilus, translation, amino acid, thr-ams, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Ligase
Deposited on 2004-05-30, released 2005-06-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.205
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: valyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1wk9a1
  • Heterogens: TSB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wk9A (A:)
    mtpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevw
    ipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrg
    ldrfearrkavelfreaghlvkeedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wk9A (A:)
    gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi
    ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr
    fearrkavelfreaghlvkeedy