PDB entry 1wk8

View 1wk8 on RCSB PDB site
Description: Isoleucyl-tRNA synthetase editing domain complexed with the pre-transfer editing substrate analogue, Val-AMS
Class: ligase
Keywords: editing, cp1, isoleucyl-trna synthetase, fidelity, thermus thermophilus, translation, amino acid, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, LIGASE
Deposited on 2004-05-30, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoleucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: iles
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56690
      • see remark 999 (79)
    Domains in SCOPe 2.07: d1wk8a_
  • Chain 'B':
    Compound: isoleucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: iles
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56690 (Start-193)
      • see remark 999 (79)
    Domains in SCOPe 2.07: d1wk8b_
  • Heterogens: VMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wk8A (A:)
    mgykeiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvg
    dealileeglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedg
    tgivhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrg
    llfkeesylhsyph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wk8A (A:)
    qdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealil
    eeglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhq
    apafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkee
    sy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wk8B (B:)
    mgykeiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvg
    dealileeglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedg
    tgivhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrg
    llfkeesylhsyph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wk8B (B:)
    dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
    eglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
    pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkees
    ylhsyph