PDB entry 1wk4

View 1wk4 on RCSB PDB site
Description: Crystal structure of ttk003001606
Deposited on 2004-05-30, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wk4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1wk4b_
  • Chain 'C':
    Domains in SCOP 1.71: d1wk4c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wk4A (A:)
    vrirragledlpgvarvlvdtwratyrgvvpeafleglsyegqaerwaqrlktptwpgrl
    fvaesesgevvgfaafgpdrasgfpgytaelwaiyvlptwqrkglgralfhegarllqae
    gygrmlvwvlkenpkgrgfyehlggvllgereielggaklwevaygfdlgghkw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wk4B (B:)
    vrirragledlpgvarvlvdtwratyrgvvpeafleglsyegqaerwaqrlktptwpgrl
    fvaesesgevvgfaafgpdrasgfpgytaelwaiyvlptwqrkglgralfhegarllqae
    gygrmlvwvlkenpkgrgfyehlggvllgereielggaklwevaygfdlgghkw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wk4C (C:)
    vrirragledlpgvarvlvdtwratyrgvvpeafleglsyegqaerwaqrlktptwpgrl
    fvaesesgevvgfaafgpdrasgfpgytaelwaiyvlptwqrkglgralfhegarllqae
    gygrmlvwvlkenpkgrgfyehlggvllgereielggaklwevaygfdlgghkw