PDB entry 1wk2

View 1wk2 on RCSB PDB site
Description: Crystal structure of a hypothetical protein from thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-30, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.327
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wk2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wk2A (A:)
    merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfs
    veellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevr
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wk2A (A:)
    merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvplyaw
    vlenafryekplhvpmfvdlsevr