PDB entry 1wk1

View 1wk1 on RCSB PDB site
Description: Solution structure of Lectin C-type domain derived from a hypothetical protein from C. elegans
Class: sugar binding protein
Keywords: Lectin C-type domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yk1067a12
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: NIG Kohara Sugano clone yk1067a12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q19853 (7-143)
      • cloning artifact (0-6)
      • cloning artifact (144-149)
    Domains in SCOPe 2.01: d1wk1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wk1A (A:)
    gssgssgvkfltvnddilsmpqarnfcasaggyladdlgddknnfyssiaantqfwiglf
    knsdgqfywdrgqginpdllnqpitywangepsndptrqcvyfdgrsgdkskvwttdtca
    tprpficqkhrydsdhkpntigdasgpssg