PDB entry 1wk0

View 1wk0 on RCSB PDB site
Description: Solution structure of Fibronectin type III domain derived from human KIAA0970 protein
Class: Structural genomics, unknown function
Keywords: fibronectin type III domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA0970 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hh13674
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2H6 (7-130)
      • cloning artifact (0-6)
      • cloning artifact (131-136)
    Domains in SCOPe 2.07: d1wk0a1, d1wk0a2, d1wk0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wk0A (A:)
    gssgssgdeetkafeallsnivkpvasdiqartvvltwsppsslingetdessvpelygy
    evlisstgkdgkyksvyvgeetnitlndlkpamdyhakvqaeynsikgtpseaeifttls
    cepdipnpprisgpssg