PDB entry 1wjz

View 1wjz on RCSB PDB site
Description: Soluiotn structure of J-domain of mouse DnaJ like protein
Class: chaperone
Keywords: J-domain, DnaJ like protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1700030A21Rik protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1700030A21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91ZF0 (7-87)
      • cloning artifact (0-6)
      • cloning artifact (88-93)
    Domains in SCOPe 2.07: d1wjza1, d1wjza2, d1wjza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjzA (A:)
    gssgssgmaleqtlkkdwysilgadpsanmsdlkqkyqklillyhpdkqsadvpagtmee
    cmqkfieidqawkilgneetkkkydlqrsgpssg