PDB entry 1wjw

View 1wjw on RCSB PDB site
Description: Solution structure of the C-terminal domain of mouse phosphoacetylglucosamine mutase (PAGM)
Class: Isomerase
Keywords: Phosphoacetylglucosamine mutase(PAGM), carbohydrate metabolism, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Isomerase
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoacetylglucosamine mutase
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2810473H05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CYR6 (7-105)
      • cloning artifact (0-6)
      • cloning artifact (106-111)
    Domains in SCOPe 2.08: d1wjwa1, d1wjwa2, d1wjwa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjwA (A:)
    gssgssgaiyvdlpnrqlkvkvadrrvisttdaerqavtppglqeaindlvkkytlaraf
    vrpsgtedivrvyaeansqesadrlayevsllvfqlaggigerpqpsgpssg