PDB entry 1wjv

View 1wjv on RCSB PDB site
Description: Solution structure of the N-terminal zinc finger domain of mouse cell growth regulating nucleolar protein LYAR
Class: DNA binding protein
Keywords: Cell growth regulating nucleolar protein LYAR, DNA-binding protein, C2H2 type zinc-finger, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell growth regulating nucleolar protein LYAR
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1700026C17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08288 (7-72)
      • cloning artifact (0-6)
      • cloning artifact (73-78)
    Domains in SCOPe 2.08: d1wjva1, d1wjva2, d1wjva3, d1wjva4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wjvA (A:)
gssgssgmvfftcnacgesvkkiqvekhvsncrnceclscidcgkdfwgddykshvkcis
egqkyggkgyeaksgpssg