PDB entry 1wju

View 1wju on RCSB PDB site
Description: Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1
Class: protein binding
Keywords: Ubiquitin-like domain, NEDD8 ultimate buster-1, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD8 ultimate buster-1
    Species: Homo sapiens [TaxId:9606]
    Gene: IMS cDNA SYN05355
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5A7 (7-93)
      • cloning artifact (0-6)
      • cloning artifact (94-99)
    Domains in SCOPe 2.08: d1wjua1, d1wjua2, d1wjua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjuA (A:)
    gssgssgdnyrttgiatievflpprlkkdrknlletrlhitgrelrskiaetfglqenyi
    kivinkkqlqlgktleeqgvahnvkamvlelkqssgpssg